Unabhängige News und Infos

Wissenschaftler James Lyons-Weiler äußert sich zur Schlangengifttheorie

childrenshealthdefense.org: Der Wissenschaftler James Lyons-Weiler, Ph.D., sagte, mindestens 10 Personen hätten ihn nach den Schlangengiftproteinen im Zusammenhang mit COVID-19 gefragt. Er schlug zwei mögliche Erklärungen vor, von denen er eine gegenüber der anderen bevorzugt.

Dr. Meryl Nass sagte, die Sache mit dem Schlangengift sei „Schwachsinn“. Meine Analyse besagt: Ja, gehen wir zu produktiveren Wegen über.

Ich nenne zwei mögliche Erklärungen für die Anwesenheit von Schlangen bei COVID-19-Patienten, von denen ich eine der anderen vorziehe.

Schlangen wurden erstmals in einem sehr frühen spekulativen Bericht, über den SciAm im Januar 2020 berichtete, als potenzieller Zwischenwirt ins Spiel gebracht, da die Codon Usage Bias ausgerechnet bei Schlangen am ähnlichsten ist.

Die Codon Usage Bias wird durch den prozentualen Anteil der Fälle bestimmt, in denen bestimmte Codons (Triplett-Nukleotide) verwendet werden, um bestimmte Aminosäuren in Proteinsequenzen zu platzieren.

Das ist zwar suggestiv, aber sehr, sehr schwach und wurde von niemandem ernsthaft als ausreichender Beweis dafür genommen, dass Schlangen die Zwischenwirte waren.

Nach der Lektüre des von Bryan Ardis zitierten Dokuments über das Gift von 2021 komme ich zu folgendem Schluss:

In Italien wurden bei 20 COVID-19-Proben und 10 Kontrollproben (Nicht-COVID-19-Patienten) in 5 Plasmaproben von COVID-19-Patienten und 3 Fäkalproben Proteine unbekannter Herkunft mit einem Proteintest nachgewiesen, der zum Nachweis von Tiergiftproteinen im Blut oder im Kot führte.

Sie sequenzierten die Proteine und fanden mehrere Arten von Giften, darunter Schlangengiftproteine.

Das war’s. Es ist eine kleine Studie.

Hier ist eine Aminosäuresequenz aus ihrer Studie, die bei vielen Gifttypen von verschiedenen Tierarten Ähnlichkeiten aufzuweisen scheint:

MKLVLAIVLILMLVSLSTGAEESGQEISMVGPPLYIWDPIPPCKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIESA

Dieses Polypeptid hat nur eine einzige Übereinstimmung in allen Lebensbäumen. Es passt zu einem Toxin von Conus pulicarius. Hier ist ein Foto:

Wikipedia

Conus pulicarius, auch Flohzapfen genannt, ist eine Meeresschneckenart, ein marines Schneckenweichtier aus der Familie der Zapfenschnecken (Conidae) und ihrer Verbündeten. (Quelle: Wikipedia).

Das Verbreitungsgebiet dieser Meeresschnecke ist: Zentral- und Westpazifik; Polynesien (nicht Marquesas); Cocos (Keeling) Island, Neuguinea und Australien (Northern Territory, Queensland und Westaustralien).

In der Studie wurden also bei Patienten in Italien Giftproteine von anderen Tieren als Schlangen gefunden, und die von Schlangen und die Sequenzen dieser Gifte sind sich alle ziemlich ähnlich.

Die Übereinstimmung beträgt 100 % und erstreckt sich über die gesamte Länge der Sequenz.

Eine ziemlich gute Übereinstimmung, würde ich sagen.

Aber – das liegt daran, dass es eine Übereinstimmung ist – mit sich selbst.

Dieses Protein stimmt mit keinem der SARS-CoV-2-Proteine überein. Und auch keines der anderen Giftproteine.

Die Studie enthält keine Beweise und behauptet nicht, dass diese Polypeptide vom SARS-CoV-2-Virus kodiert werden. Sie berichtet lediglich, dass die Giftproteine bei SARS-CoV-2-Patienten, nicht aber bei Kontrollpersonen gefunden wurden.

Metaboliten?

Hier ist ein Link zu einem Nachrichtenartikel über eine Studie, die besagt, dass Metaboliten bei COVID-19-Patienten – Produkte des menschlichen Körpers – giftig sein können und wie Schlangengift wirken können.

Hier ist ein Link zum selben Artikel, aber von einer anderen Quelle.

Und hier ist ein Link zu der Studie, auf die sie sich beziehen, über die menschliche sekretorische Phospholipase A2.

Bedeutet dies, dass der menschliche Körper als Reaktion auf eine SARS-CoV-2-Infektion Gift produziert?

Es gibt keine Übereinstimmung zwischen dem menschlichen sekretorischen Phospholipase A2-Protein.

Tiergifte als Mittel zur Behandlung von Autoimmunität?

Einige Studien haben ergeben, dass Gifte, einschließlich Schlangengifte, das CD4/CD8-Ungleichgewicht, das bei schweren Fällen von COVID-19 auftritt, wiederherstellen können:

„Viele Gifte sind multifunktional und haben mehrere biologische Ziele, die möglicherweise nichts mit ihrer toxischen Rolle zu tun haben. Einige aus Toxinen gewonnene Peptide werden heute zur Behandlung von Typ-2-Diabetes, Bluthochdruck, neuropathischen Schmerzen und anderen Erkrankungen eingesetzt.

„Einige Daten bestätigen die Wirkung von Bienengift (BV) auf die Vorbeugung und Verbesserung von COVID-19 [1]. Andere Daten ignorieren die Wirkung von Bienengift zur Vorbeugung von COVID-19 und stellen die Hypothese auf, dass die geringere SARS-CoV-2-Infektion bei Imkern darauf zurückzuführen ist, dass sie weniger Kontakt zu anderen Menschen haben [3].

„Eine niedrige Dosis Botulinum-Neurotoxin (BoNT) kann die Symptome von COVID-19 reduzieren und könnte daher in Behandlungslinien eingesetzt werden [14]. Es hat sich gezeigt, dass die Rate der DTP-Impfung eine umgekehrte Korrelation mit der COVID-19-Prävalenz aufweist [15].

„Cobrotoxin hat eine entzündungshemmende Wirkung und kann auch das CD4/CD8-Verhältnis wiederherstellen und eine immunprotektive Wirkung gegen SARS-CoV-2 entfalten [16]. Tetrodotoxin ist ein Inhibitor des MPro von SARS-CoV-2 und kann somit das Virus beeinflussen [17].“

Einige relevante Fragen:

  • Fünf Kontrollproben sind zu wenig. Wie viele Personen ohne COVID-19 haben das Protein im Blut oder im Stuhl?
  • Haben diese Patienten sich selbst (oder unter ärztlicher Aufsicht) wegen COVID-19 (oder einer anderen Autoimmunität) mit Tiergiften behandelt?

Wir wissen, dass Patienten mit schwerem COVID-19 höchstwahrscheinlich bereits eine Autoimmunität hatten. Bei schwerem COVID-19 mit Autoimmunität sind es etwa 80 %, bei leichtem COVID-19 nur etwa 8 %. Das ist ein enormer Unterschied in der Prävalenz der Autoimmunität im Zusammenhang mit den COVID-19-Ergebnissen.

Meine bevorzugte Hypothese ist, dass Autoimmunpatienten in Italien, die Tiergifte zur Behandlung ihrer Autoimmunität – oder zur Abwehr von COVID-19 – verwenden, die Wissenschaftler, die diese Gifte oder deren Metaboliten in ihren Fäkalien und ihrem Blut finden, gehörig verwirrt haben.

Es ist aber auch möglich, dass wir als Reaktion auf eine SARS-CoV-2-Infektion Proteine produzieren, die den Giften anderer Arten entsprechen. Unwahrscheinlich, aber ich kann es nicht ausschließen.

Hier ist ein Artikel über Venom-Immuntherapie aus Brasilien mit ausführlichen Zitaten von Studien über Venom-Proteine zur Behandlung von Autoimmunität.

Denken Sie daran, dass SARS-CoV-2 als „jeder wird sterben“ angepriesen wurde – und die Verbindung zwischen früherer Autoimmunität und schwerem SARS-CoV-2 ist sehr, sehr stark.

Ich wäre neugierig zu erfahren, ob jemand Hinweise auf die Häufigkeit von Tiergiftinjektionen zur Behandlung von Autoimmunität oder von Versuchen zur Behandlung von COVID-19 in Italien hat.

Beteffend: ‚Watch the Water

Wenn Sie Schlangengift zu sich nehmen… nun, es ist ein Protein, und wenn Sie wissen wollen, was mit Proteinen in unseren Mägen passiert, brauchen Sie nur im Internet zu suchen.

Ich habe keine endgültige Antwort, aber ich weiß, dass das Gift injiziert oder körpereigen produziert werden muss, um im Blut oder im Kot eines Menschen gefunden zu werden.

p.s. Lesen Sie den Artikel von Dr. Nass, um ihre Meinung zu erfahren. Übrigens habe ich Dr. Nass für die dieswöchige „America Out Loud“ Pulse Episode interviewt, die am Freitag ausgestrahlt wird, und zwar zum Versagen der U.S. Food and Drug Administration (FDA), ihren eigenen Richtlinien zu den SARS-CoV-2-Impfstoffen zu folgen, nachdem sie die Wirksamkeit mit realen Daten infrage gestellt hatten. Achten Sie auf die Sendung „America Out Loud“ und dieses Wochenende auf Ihren bevorzugten Podcast-Plattformen.